PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00295.180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 300aa    MW: 34308.1 Da    PI: 9.6123
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00295.180genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.21.8e-334699255
         G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    prlrWtp+LH++Fv+ave+LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  Jcr4S00295.180 46 PRLRWTPDLHHCFVHAVERLGGEDRATPKMVLQIMNVKGLTISHVKSHLQMYRS 99
                    8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-3242101IPR009057Homeodomain-like
PROSITE profilePS5129410.94642102IPR017930Myb domain
SuperFamilySSF466891.06E-1544100IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-2546100IPR006447Myb domain, plants
PfamPF002493.1E-84798IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKSRTSPSSS LHNYDPRVTR RRIGDNLSGI TLKSPMVRPY VRSKMPRLRW TPDLHHCFVH  60
AVERLGGEDR ATPKMVLQIM NVKGLTISHV KSHLQMYRSM KHEQMIQEAA IAAKKNEKAS  120
GIHHSNYFSH LLDSTCCQQN HQLKEKGFIN NASVLYQGHG AQDSPTNRVA LMNTTMSVQR  180
KQKGEMWIGN KSLTESFSHE QVKSKEWEQK RTDSYIIFND ILLKRCTTQE SNGEDNNMAS  240
SVDGTEWDKN HEDFVEIAKR EEADKMSLLL KPKASVESLL KLKKAENLYV EDVSLELTLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012092370.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A067JAG40.0A0A067JAG4_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-33G2-like family protein